PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 261aa    MW: 29852.5 Da    PI: 10.3674
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00611genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-18550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
       AA31G00611  5 RGHWRPAEDEKLRDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 50
                     899*****************************.***********996 PP

2Myb_DNA-binding54.23.4e-1757100146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++++eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
       AA31G00611  57 RNPFSEEEEEKLLASHRIHGNR-WSVIARLFP-GRTDNAVKNHWHV 100
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.913155IPR017930Myb domain
SMARTSM007171.6E-15453IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-29598IPR009057Homeodomain-like
PfamPF002492.4E-17550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-27658IPR009057Homeodomain-like
CDDcd001674.18E-15849No hitNo description
SMARTSM007171.2E-1556104IPR001005SANT/Myb domain
PROSITE profilePS5129419.40856106IPR017930Myb domain
PfamPF002492.6E-145799IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2159104IPR009057Homeodomain-like
CDDcd001679.61E-135999No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MMCSRGHWRP AEDEKLRDLV EQYGPHNWNA IALKLPGRSG KSCRLRWFNQ LDPRINRNPF  60
SEEEEEKLLA SHRIHGNRWS VIARLFPGRT DNAVKNHWHV IMARRSRRRQ TSTNHHHKLN  120
RTHRFLLDNL SSKTTVNAAA AEQMMIMVGS TGSSPNRNIK PAVCSTTNVI NYPPYQFSNV  180
NHFQLLKDFL AGKIGFQNAF NAKANESTKS VEFYDFLQIK TDSDKSEVSA PQDSDQDNNS  240
NNKNANLVPF FDFLSVGKSA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-3121051104C-Myb DNA-Binding Domain
1msf_C5e-3121051104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106005.11e-108PREDICTED: transcription factor WER
TrEMBLA0A087HI301e-110A0A087HI30_ARAAL; Uncharacterized protein
STRINGBra015992.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-99myb domain protein 52